KIAA1958 Antibody

Name KIAA1958 Antibody
Supplier Novus Biologicals
Catalog NBP1-56708
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KIAA1958(KIAA1958) The peptide sequence was selected from the C terminal of KIAA1958. Peptide sequence SPITLLSTVVKYNSQYLNMRTLQEHADLMYGDIELLKDPQNQPYFARTDS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KIAA1958
Conjugate Unconjugated
Supplier Page Shop

Product images