LRRC42 Antibody

Name LRRC42 Antibody
Supplier Novus Biologicals
Catalog NBP1-56701
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LRRC42(leucine rich repeat containing 42) The peptide sequence was selected from the N terminal of LRRC42. Peptide sequence LIGFPEQIAEKLFSAAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LRRC42
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.