Serine/threonine-protein kinase NIM1 Antibody
| Name | Serine/threonine-protein kinase NIM1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56740 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MGC42105(hypothetical protein MGC42105) The peptide sequence was selected from the middle region of MGC42105. Peptide sequence LSKLHLVMEYAGGGELFGKISTEGKLSEPESKLIFSQIVSAVKHMHENQI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NIM1K |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Serine/threonine-protein kinase NIM1 Antibody [NBP1-56740] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16960_Serine-threonine-protein%2520kinase%2520NIM1%2520Antibody-Western%2520Blot-NBP1-56740-img0002.jpg)
Western Blot: Serine/threonine-protein kinase NIM1 Antibody [NBP1-56740] - Jurkat cell lysate, concentration 0.2-1 ug/ml.