LACC1 Antibody
| Name | LACC1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56736 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C13ORF31 The peptide sequence was selected from the middle region of C13ORF31. Peptide sequence TIITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVVQEN. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LACC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: LACC1 Antibody [NBP1-56736] - Human Lung lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16340_LACC1-Antibody-Western-Blot-NBP1-56736-img0003.jpg)
Western Blot: LACC1 Antibody [NBP1-56736] - Human Lung lysate, concentration 0.2-1 ug/ml.