AMDHD1 Antibody

Name AMDHD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56721
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to AMDHD1(amidohydrolase domain containing 1) The peptide sequence was selected from the N terminal of AMDHD1. Peptide sequence AVLEGASLVVGKDGFIKAIGPADVIQRQFSGETFEEIIDCSGKCILPGLV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene AMDHD1
Conjugate Unconjugated
Supplier Page Shop

Product images