LSM12 Antibody

Name LSM12 Antibody
Supplier Novus Biologicals
Catalog NBP1-56720
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LSM12(LSM12 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of LSM12. Peptide sequence PPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAAL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LSM12
Conjugate Unconjugated
Supplier Page Shop

Product images