AKR7A3 Antibody

Name AKR7A3 Antibody
Supplier Novus Biologicals
Catalog NBP1-56768
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to AKR7A3(aldo-keto reductase family 7, member A3 (aflatoxin aldehyde reductase)) The peptide sequence was selected from the middle region of AKR7A3. Peptide sequence VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGK
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene AKR7A3
Conjugate Unconjugated
Supplier Page Shop

Product images