CCDC7 Antibody

Name CCDC7 Antibody
Supplier Novus Biologicals
Catalog NBP1-56757
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CCDC7(coiled-coil domain containing 7) The peptide sequence was selected from the N terminal of CCDC7. Peptide sequence KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CCDC7
Conjugate Unconjugated
Supplier Page Shop

Product images