Name | GOLGA7B Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56754 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Bovine, Zebrafish |
Antigen | Synthetic peptides corresponding to C10ORF132 The peptide sequence was selected from the N terminal of C10ORF132. Peptide sequence MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | GOLGA7B |
Supplier Page | Shop |