GOLGA7B Antibody

Name GOLGA7B Antibody
Supplier Novus Biologicals
Catalog NBP1-56754
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Bovine, Zebrafish
Antigen Synthetic peptides corresponding to C10ORF132 The peptide sequence was selected from the N terminal of C10ORF132. Peptide sequence MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene GOLGA7B
Supplier Page Shop

Product images