ABRO Antibody
| Name | ABRO Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56788 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to KIAA0157 The peptide sequence was selected from the middle region of KIAA0157. Peptide sequence GDSGEDSDDSDYENLIDPTEPSNSEYSHSKDSRPMAHPDEDPRNTQTSQI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | FAM175B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ABRO Antibody [NBP1-56788] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24199_ABRO-Antibody-Western-Blot-NBP1-56788-img0003.jpg)
Western Blot: ABRO Antibody [NBP1-56788] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
![Western Blot: ABRO Antibody [NBP1-56788] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate FAM175B is supported by BioGPS gene expression data to be expressed in HepG2](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24200_ABRO%2520Antibody-Western%2520Blot-NBP1-56788-img0004.jpg)
Western Blot: ABRO Antibody [NBP1-56788] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate FAM175B is supported by BioGPS gene expression data to be expressed in HepG2