ABH2 Antibody

Name ABH2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56921
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ALKBH2(alkB, alkylation repair homolog 2 (E. coli)) The peptide sequence was selected from the middle region of ABH2 (NP_001001655). Peptide sequence VPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ALKBH2
Conjugate Unconjugated
Supplier Page Shop

Product images