Calcineurin B Antibody

Name Calcineurin B Antibody
Supplier Novus Biologicals
Catalog NBP1-56816
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PPP3R1(protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform) The peptide sequence was selected from the N terminal of PPP3R1. Peptide sequence MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSV
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PPP3R1
Conjugate Unconjugated
Supplier Page Shop

Product images