Name | Calcineurin B Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56816 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to PPP3R1(protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform) The peptide sequence was selected from the N terminal of PPP3R1. Peptide sequence MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSV |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | PPP3R1 |
Conjugate | Unconjugated |
Supplier Page | Shop |