TEX19 Antibody

Name TEX19 Antibody
Supplier Novus Biologicals
Catalog NBP1-56811
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FLJ35767(FLJ35767 protein) The peptide sequence was selected from the middle region of FLJ35767. Peptide sequence PEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDADWTQGLPWRFEELLTCS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TEX19
Conjugate Unconjugated
Supplier Page Shop

Product images