RPS27L Antibody

Name RPS27L Antibody
Supplier Novus Biologicals
Catalog NBP1-56857
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RPS27L(ribosomal protein S27-like) The peptide sequence was selected from the N terminal of RPS27L. Peptide sequence MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RPS27L
Conjugate Unconjugated
Supplier Page Shop

Product images