RPS14 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57365
• Prices: $299.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to RPS14 (ribosomal protein S14) The peptide sequence was selected from the middle region of RPS14. Peptide sequence GNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL.
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: RPS14
• Conjugate: Unconjugated

Product images

Western Blot: RPS14 Antibody [NBP1-57365] - Jurkat, Antibody Dilution: 1.0 ug/ml RPS14 is supported by BioGPS gene expression data to be expressed in Jurkat.

Western Blot: RPS14 Antibody [NBP1-57365] - Titration: 2.5ug/ml, Positive Control: HepG2 cell lysate.

Western Blot: RPS14 Antibody [NBP1-57365] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml RPS14 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Western Blot: RPS14 Antibody [NBP1-57365] - Hela, Antibody Dilution: 1.0 ug/ml RPS14 is supported by BioGPS gene expression data to be expressed in HeLa.

Western Blot: RPS14 Antibody [NBP1-57365] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Western Blot: RPS14 Antibody [NBP1-57365] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Western Blot: RPS14 Antibody [NBP1-57365] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Western Blot: RPS14 Antibody [NBP1-57365] - MCF7, Antibody Dilution: 1.0 ug/ml RPS14 is supported by BioGPS gene expression data to be expressed in MCF7.