Splicing factor, arginine/serine-rich 11 Antibody

Name Splicing factor, arginine/serine-rich 11 Antibody
Supplier Novus Biologicals
Catalog NBP1-57324
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SFRS11(splicing factor, arginine/serine-rich 11) The peptide sequence was selected from the C terminal of SFRS11. Peptide sequence KKKSKDKEKDRERKSESDKDVKQVTRDYDEEEQGYDSEKEKKEEKKPIET.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SRSF11
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.