DDX50 Antibody

Name DDX50 Antibody
Supplier Novus Biologicals
Catalog NBP1-57289
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DDX50 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 50) The peptide sequence was selected from the N terminal of DDX50. Peptide sequence EESESQKKERQKSDRRKSRHHYDSDEKSETRENGVTDDLDAPKAKKSKMK.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene DDX50
Conjugate Unconjugated
Supplier Page Shop

Product images