ADAD2 Antibody

Name ADAD2 Antibody
Supplier Novus Biologicals
Catalog NBP1-57403
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ADAD2(adenosine deaminase domain containing 2) The peptide sequence was selected from the middle region of ADAD2. Peptide sequence GQQLHDCHGLVIARRALLRFLFRQLLLATQGGPKGKEQSVLAPQPGPGPP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ADAD2
Conjugate Unconjugated
Supplier Page Shop

Product images