TCP10L Antibody
| Name | TCP10L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-52846 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TCP10L(t-complex 10 (mouse)-like) The peptide sequence was selected from the middle region of TCP10L. Peptide sequence ASPHAGQESHTLALEPAFGKISPLSADEETIPKYAGHKNQSATLLGQRSS. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | TCP10L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TCP10L Antibody [NBP1-52846] - Titration: 1.25ug/ml Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24939_TCP10L-Antibody-Western-Blot-NBP1-52846-img0003.jpg)
Western Blot: TCP10L Antibody [NBP1-52846] - Titration: 1.25ug/ml Positive Control: HepG2 cell lysate.
![Immunohistochemistry-Paraffin: TCP10L Antibody [NBP1-52846] - Human Heart Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Myocardial cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24940_TCP10L-Antibody-Immunohistochemistry-Paraffin-NBP1-52846-img0002.jpg)
Immunohistochemistry-Paraffin: TCP10L Antibody [NBP1-52846] - Human Heart Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Myocardial cells (indicated with arrows) 400X magnification.