PHACS Antibody

Name PHACS Antibody
Supplier Novus Biologicals
Catalog NBP1-52839
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PHACS The peptide sequence was selected from the middle region of PHACS. Peptide sequence RSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLC.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene ACCS
Conjugate Unconjugated
Supplier Page Shop

Product images