gamma C Crystallin Antibody

Name gamma C Crystallin Antibody
Supplier Novus Biologicals
Catalog NBP1-52908
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CRYGC(crystallin, gamma C) The peptide sequence was selected from the middle region of CRYGC. Peptide sequence GLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CRYGC
Conjugate Unconjugated
Supplier Page Shop

Product images