PIP5KL1 Antibody
| Name | PIP5KL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-52922 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PIP5KL1(phosphatidylinositol-4-phosphate 5-kinase-like 1) The peptide sequence was selected from the middle region of PIP5KL1. Peptide sequence VLDYSLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLP. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PIP5KL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PIP5KL1 Antibody [NBP1-52922] - Titration: 0.2-1 ug/ml Positive Control: Human Lung.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14740_PIP5KL1%2520Antibody-Western%2520Blot-NBP1-52922-img0003.jpg)
Western Blot: PIP5KL1 Antibody [NBP1-52922] - Titration: 0.2-1 ug/ml Positive Control: Human Lung.