alpha Tubulin 3c Antibody
| Name | alpha Tubulin 3c Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-53026 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TUBA3C(tubulin, alpha 3c) The peptide sequence was selected from the N terminal of TUBA3C. Peptide sequence VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TUBA3C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: alpha Tubulin 3c Antibody [NBP1-53026] - Hela, Antibody Dilution: 1.0 ug/ml TUBA3C is supported by BioGPS gene expression data to be expressed in HeLa.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24423_alpha-Tubulin-3c-Antibody-Western-Blot-NBP1-53026-img0003.jpg)
Western Blot: alpha Tubulin 3c Antibody [NBP1-53026] - Hela, Antibody Dilution: 1.0 ug/ml TUBA3C is supported by BioGPS gene expression data to be expressed in HeLa.
![Western Blot: alpha Tubulin 3c Antibody [NBP1-53026] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24424_alpha-Tubulin-3c-Antibody-Western-Blot-NBP1-53026-img0002.jpg)
Western Blot: alpha Tubulin 3c Antibody [NBP1-53026] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: alpha Tubulin 3c Antibody [NBP1-53026] - Jurkat, Antibody Dilution: 1.0 ug/ml TUBA3C is supported by BioGPS gene expression data to be expressed in Jurkat.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24425_alpha%2520Tubulin%25203c%2520Antibody-Western%2520Blot-NBP1-53026-img0004.jpg)
Western Blot: alpha Tubulin 3c Antibody [NBP1-53026] - Jurkat, Antibody Dilution: 1.0 ug/ml TUBA3C is supported by BioGPS gene expression data to be expressed in Jurkat.