alpha Tubulin 3c Antibody

Name alpha Tubulin 3c Antibody
Supplier Novus Biologicals
Catalog NBP1-53014
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Drosophila, Plant
Antigen Synthetic peptides corresponding to TUBA3C(tubulin, alpha 3c) The peptide sequence was selected from the N terminal of TUBA3C (NP_005992). Peptide sequence: QMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYR.
Purity/Format Affinity purified
Description Rabbit Polyclonal
Gene TUBA3C
Supplier Page Shop

Product images