Name | alpha Tubulin 3c Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-53014 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Drosophila, Plant |
Antigen | Synthetic peptides corresponding to TUBA3C(tubulin, alpha 3c) The peptide sequence was selected from the N terminal of TUBA3C (NP_005992). Peptide sequence: QMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYR. |
Purity/Format | Affinity purified |
Description | Rabbit Polyclonal |
Gene | TUBA3C |
Supplier Page | Shop |