NUDT12 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-52974
• Prices: $139.00, $299.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to NUDT12(nudix (nucleoside diphosphate linked moiety X)-type motif 12) The peptide sequence was selected from the C terminal of NUDT12. Peptide sequence LALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIAHQ.
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: NUDT12
• Conjugate: Unconjugated