LAP3 Antibody
| Name | LAP3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-53152 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to LAP3(leucine aminopeptidase 3) The peptide sequence was selected from the N terminal of LAP3. Peptide sequence LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LAP3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: LAP3 Antibody [NBP1-53152] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14271_LAP3-Antibody-Western-Blot-NBP1-53152-img0004.jpg)
Western Blot: LAP3 Antibody [NBP1-53152] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
![Western Blot: LAP3 Antibody [NBP1-53152] - Human Heart lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14272_LAP3-Antibody-Western-Blot-NBP1-53152-img0002.jpg)
Western Blot: LAP3 Antibody [NBP1-53152] - Human Heart lysate, concentration 0.2-1 ug/ml.
![Western Blot: LAP3 Antibody [NBP1-53152] - Human 721_B, Antibody Dilution: 1.0 ug/ml LAP3 is supported by BioGPS gene expression data to be expressed in 721_B.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14273_LAP3-Antibody-Western-Blot-NBP1-53152-img0003.jpg)
Western Blot: LAP3 Antibody [NBP1-53152] - Human 721_B, Antibody Dilution: 1.0 ug/ml LAP3 is supported by BioGPS gene expression data to be expressed in 721_B.
![Western Blot: LAP3 Antibody [NBP1-53152] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14274_LAP3%2520Antibody-Western%2520Blot-NBP1-53152-img0005.jpg)
Western Blot: LAP3 Antibody [NBP1-53152] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.