Name | HCFC1R1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-53070 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat, Bovine, Dog, Goat |
Antigen | Synthetic peptides corresponding to HCFC1R1(host cell factor C1 regulator 1 (XPO1 dependent)) The peptide sequence was selected from the middle region of HCFC1R1. Peptide sequence LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | HCFC1R1 |
Supplier Page | Shop |