HCFC1R1 Antibody

Name HCFC1R1 Antibody
Supplier Novus Biologicals
Catalog NBP1-53070
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat, Bovine, Dog, Goat
Antigen Synthetic peptides corresponding to HCFC1R1(host cell factor C1 regulator 1 (XPO1 dependent)) The peptide sequence was selected from the middle region of HCFC1R1. Peptide sequence LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene HCFC1R1
Supplier Page Shop

Product images