PAPD4 Antibody

Name PAPD4 Antibody
Supplier Novus Biologicals
Catalog NBP1-53057
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PAPD4(PAP associated domain containing 4) The peptide sequence was selected from the N terminal of PAPD4. Peptide sequence GRKRLSDEKNLPLDGKRQRFHSPHQEPTVVNQIVPLSGERRYSMPPLFHT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PAPD4
Conjugate Unconjugated
Supplier Page Shop

Product images