MPP7 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-53081
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to MPP7(membrane protein, palmitoylated 7 (MAGUK p55 subfamily member 7)) The peptide sequence was selected from the N terminal of MPP7. Peptide sequence MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSL.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: MPP7
• Conjugate: Unconjugated