ACTR1A Antibody

Name ACTR1A Antibody
Supplier Novus Biologicals
Catalog NBP1-53075
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ACTR1A(ARP1 actin-related protein 1 homolog A, centractin alpha (yeast)) The peptide sequence was selected from the middle region of ACTR1A. Peptide sequence AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPE
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ACTR1A
Conjugate Unconjugated
Supplier Page Shop

Product images