C17orf39 Antibody

Name C17orf39 Antibody
Supplier Novus Biologicals
Catalog NBP1-53185
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C17ORF39 The peptide sequence was selected from the C terminal of C17ORF39. Peptide sequence SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GID4
Conjugate Unconjugated
Supplier Page Shop

Product images