TIMM44 Antibody
| Name | TIMM44 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54381 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | Synthetic peptides corresponding to TIMM44(translocase of inner mitochondrial membrane 44 homolog (yeast)) The peptide sequence was selected from the N terminal of TIMM44. Peptide sequence MAAAALRSGWCRCPRRCLGSGIQFLSSHNLPHGSTYQMRRPGGELPLSKS |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TIMM44 |
| Supplier Page | Shop |
Product images
![Western Blot: TIMM44 Antibody [NBP1-54381] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/3779_TIMM44%2520Antibody-Western%2520Blot-NBP1-54381-img0003.jpg)
Western Blot: TIMM44 Antibody [NBP1-54381] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.