OCIAD1 Antibody

Name OCIAD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-54905
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OCIAD1(OCIA domain containing 1) The peptide sequence was selected from the C terminal of OCIAD1. Peptide sequence QGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OCIAD1
Conjugate Unconjugated
Supplier Page Shop

Product images