Name | CHST14 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55174 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Bovine, Dog |
Antigen | Synthetic peptides corresponding to CHST14(carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14) The peptide sequence was selected from the middle region of CHST14. Peptide sequence REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHW |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | CHST14 |
Supplier Page | Shop |