CHST14 Antibody

Name CHST14 Antibody
Supplier Novus Biologicals
Catalog NBP1-55174
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog
Antigen Synthetic peptides corresponding to CHST14(carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14) The peptide sequence was selected from the middle region of CHST14. Peptide sequence REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHW
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene CHST14
Supplier Page Shop

Product images