GSTZ1 Antibody

Name GSTZ1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55137
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GSTZ1(glutathione transferase zeta 1 (maleylacetoacetate isomerase)) The peptide sequence was selected from the N terminal of GSTZ1. Peptide sequence MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene GSTZ1
Conjugate Unconjugated
Supplier Page Shop

Product images