EPB41 Antibody
| Name | EPB41 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55096 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog, Horse, Rabbit |
| Antigen | Synthetic peptides corresponding to EPB41(erythrocyte membrane protein band 4.1) The peptide sequence was selected from the N terminal of EPB41. Peptide sequence SESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLD. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | EPB41 |
| Supplier Page | Shop |
Product images
![Western Blot: EPB41 Antibody [NBP1-55096] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/3793_EPB41%2520Antibody-Western%2520Blot-NBP1-55096-img0002.jpg)
Western Blot: EPB41 Antibody [NBP1-55096] - Jurkat cell lysate, concentration 0.2-1 ug/ml.