DCUN1D3 Antibody

Name DCUN1D3 Antibody
Supplier Novus Biologicals
Catalog NBP1-55423
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DCUN1D3(DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae)) The peptide sequence was selected from the C terminal of DCUN1D3. Peptide sequence LNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLS
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DCUN1D3
Conjugate Unconjugated
Supplier Page Shop

Product images