Name | DCUN1D3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55423 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to DCUN1D3(DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae)) The peptide sequence was selected from the C terminal of DCUN1D3. Peptide sequence LNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLS |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | DCUN1D3 |
Conjugate | Unconjugated |
Supplier Page | Shop |