UBLCP1 Antibody
| Name | UBLCP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55421 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to UBLCP1(ubiquitin-like domain containing CTD phosphatase 1) The peptide sequence was selected from the N terminal of UBLCP1. Peptide sequence MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | UBLCP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: UBLCP1 Antibody [NBP1-55421] - Lanes: 1: CD4 T cell lysate from WT mice, 2: CD4 T cell lysate from WT mice treated with anti-CD3/CD28, 3: CD4 T cell lysate from WT mice treated with FK506, 4: CD4 T cell lysate from WT mice treated with anti-CD3/CD28 and FK506, 5: CD4 T cell lysate from](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/29999_UBLCP1-Antibody-Western-Blot-NBP1-55421-img0004.jpg)
Western Blot: UBLCP1 Antibody [NBP1-55421] - Lanes: 1: CD4 T cell lysate from WT mice, 2: CD4 T cell lysate from WT mice treated with anti-CD3/CD28, 3: CD4 T cell lysate from WT mice treated with FK506, 4: CD4 T cell lysate from WT mice treated with anti-CD3/CD28 and FK506, 5: CD4 T cell lysate from
![Western Blot: UBLCP1 Antibody [NBP1-55421] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human Thymus](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/0_UBLCP1-Antibody-Western-Blot-NBP1-55421-img0003.jpg)
Western Blot: UBLCP1 Antibody [NBP1-55421] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human Thymus