SUNC1 Antibody

Name SUNC1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55413
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SUNC1(Sad1 and UNC84 domain containing 1) The peptide sequence was selected from the C terminal of SUNC1. Peptide sequence IKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SUN3
Conjugate Unconjugated
Supplier Page Shop

Product images