Name | ANKMY2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55412 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to ANKMY2(ankyrin repeat and MYND domain containing 2) Antibody(against the N terminal of ANKMY2 (NP_064715). Peptide sequence MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPL. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | ANKMY2 |
Conjugate | Unconjugated |
Supplier Page | Shop |