ANKMY2 Antibody

Name ANKMY2 Antibody
Supplier Novus Biologicals
Catalog NBP1-55412
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ANKMY2(ankyrin repeat and MYND domain containing 2) Antibody(against the N terminal of ANKMY2 (NP_064715). Peptide sequence MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ANKMY2
Conjugate Unconjugated
Supplier Page Shop

Product images