MASA Antibody

Name MASA Antibody
Supplier Novus Biologicals
Catalog NBP1-55361
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Pig, Dog, Guinea Pig
Antigen Synthetic peptides corresponding to ENOPH1(enolase-phosphatase 1) Antibody(against the N terminal of ENOPH1. Peptide sequence IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ENOPH1
Supplier Page Shop

Product images