Name | MASA Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55361 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Pig, Dog, Guinea Pig |
Antigen | Synthetic peptides corresponding to ENOPH1(enolase-phosphatase 1) Antibody(against the N terminal of ENOPH1. Peptide sequence IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | ENOPH1 |
Supplier Page | Shop |