FBXO28 Antibody

Name FBXO28 Antibody
Supplier Novus Biologicals
Catalog NBP1-55341
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FBXO28(F-box protein 28) The peptide sequence was selected from the middle region of FBXO28. Peptide sequence ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FBXO28
Conjugate Unconjugated
Supplier Page Shop

Product images