FUNDC1 Antibody

Name FUNDC1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55388
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FUNDC1(FUN14 domain containing 1) The peptide sequence was selected from the N terminal of FUNDC1. Peptide sequence MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FUNDC1
Conjugate Unconjugated
Supplier Page Shop

Product images