LYSMD1 Antibody

Name LYSMD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55447
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LYSMD1(LysM, putative peptidoglycan-binding, domain containing 1) The peptide sequence was selected from the N terminal of LYSMD1. Peptide sequence VRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDSIFLKKTLYI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LYSMD1
Conjugate Unconjugated
Supplier Page Shop

Product images