C2orf47 Antibody
| Name | C2orf47 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57840 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C2ORF47 The peptide sequence was selected from the middle region of C2ORF47. Peptide sequence GASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | C2orf47 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: C2orf47 Antibody [NBP1-57840] - Human Liver cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15542_C2orf47%2520Antibody-Western%2520Blot-NBP1-57840-img0002.jpg)
Western Blot: C2orf47 Antibody [NBP1-57840] - Human Liver cell lysate, concentration 0.2-1 ug/ml.