PNPLA4 Antibody

Name PNPLA4 Antibody
Supplier Novus Biologicals
Catalog NBP1-57925
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PNPLA4(patatin-like phospholipase domain containing 4) The peptide sequence was selected from the C terminal of PNPLA4. Peptide sequence SPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKM.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PNPLA4
Conjugate Unconjugated
Supplier Page Shop

Product images