Name | PNPLA4 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57925 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to PNPLA4(patatin-like phospholipase domain containing 4) The peptide sequence was selected from the C terminal of PNPLA4. Peptide sequence SPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKM. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | PNPLA4 |
Conjugate | Unconjugated |
Supplier Page | Shop |