Wnt-9b Antibody
| Name | Wnt-9b Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57937 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to WNT9B (wingless-type MMTV integration site family, member 9B) The peptide sequence was selected from the C terminal of WNT9B. Peptide sequence FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | WNT9B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Wnt-9b Antibody [NBP1-57937] - Jurkat cell lysate, Antibody Titration: 5.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24448_Wnt-9b-Antibody-Western-Blot-NBP1-57937-img0004.jpg)
Western Blot: Wnt-9b Antibody [NBP1-57937] - Jurkat cell lysate, Antibody Titration: 5.0ug/ml
![Immunohistochemistry-Paraffin: Wnt-9b Antibody [NBP1-57937] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24449_Wnt-9b-Antibody-Immunohistochemistry-Paraffin-NBP1-57937-img0003.jpg)
Immunohistochemistry-Paraffin: Wnt-9b Antibody [NBP1-57937] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.