Chymotrypsin-like protease Antibody

Name Chymotrypsin-like protease Antibody
Supplier Novus Biologicals
Catalog NBP1-58002
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CTRL(chymotrypsin-like) The peptide sequence was selected from the N terminal of CTRL. Peptide sequence SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CTRL
Conjugate Unconjugated
Supplier Page Shop

Product images