| Name | PSG-1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58001 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PSG1(pregnancy specific beta-1-glycoprotein 1) The peptide sequence was selected from the N terminal of PSG1. Peptide sequence SGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLE. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | PSG1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |