ZG16 Antibody

Name ZG16 Antibody
Supplier Novus Biologicals
Catalog NBP1-58007
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ZG16(zymogen granule protein 16) The peptide sequence was selected from the middle region of ZG16. Peptide sequence WSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZG16
Conjugate Unconjugated
Supplier Page Shop

Product images